PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10014194
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 413aa    MW: 44286 Da    PI: 5.542
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10014194genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.28.5e-14317369557
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                  +r+rr++kNRe+A rsR+RK+a++ eLe +  +L++eN++Lk+ l e++ + +
  Lus10014194 317 RRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENRQLKQALAEMERKRK 369
                  79****************************************76666655544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.7E-14310369No hitNo description
SMARTSM003388.5E-13313374IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.634315367IPR004827Basic-leucine zipper domain
CDDcd147073.00E-23317371No hitNo description
SuperFamilySSF579591.75E-10317367No hitNo description
PfamPF001701.6E-11317370IPR004827Basic-leucine zipper domain
PROSITE patternPS000360320335IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MGDQEMNSNG EVESALQLDN QSNNNKSNNP FPSLGRQSSI YSLTLDEFQH TLCGEGGKNF  60
GSMNMDEFLN SIWTAEENQH PNPAAAAANV SHAPLPGGSS NGGGSGDHLP GRGISKQPSL  120
PRQGSLSLPE KLCRKTVDEV WSEIHSRNRK FGGGPRKTGE NTEANSNSQV NVRNNSESTA  180
RQPTFGEMTL EDFLIKAGVV REQQCGGGAA PSYLPPQQYG MFLPRGGGSS GSISYPLPPL  240
PPYSGRVGNG VVGGGYAPPP PPSSQSLAVV GPVSPVSSDG MVAANIDAVG NHYGMDMGGL  300
RGRKRIIDGP VEKVVERRQR RMIKNRESAA RSRARKQAYT VELEAELNQL KEENRQLKQA  360
LAEMERKRKQ QLSCGAVPRG NEIEGTEQEG AGEADADEEE FELSIMIRDN DT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012066490.11e-126PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5
SwissprotQ9SJN01e-114ABI5_ARATH; Protein ABSCISIC ACID-INSENSITIVE 5
TrEMBLA0A067L6C21e-126A0A067L6C2_JATCU; Uncharacterized protein
STRINGSolyc09g009490.2.11e-118(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20923374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36270.13e-44bZIP family protein